Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQSLFYDTIPIIPLFHVHIGTPMSDQTYINQQWLETNPLTTETVLTYFALSPFYDRSSLNEILKMQTQFTNFLDFSKKLTELNGVKYLVDQRNDVFFIYKIHKQKDNEDLLDFYYVLFGTIYKGATTNGIFRTRVFNLLFFINESLPKYLKRRRFSAVEGFKMKSDEEIGAKESEETVEDKEIAEHVIRDIYTG |
Length | 194 |
Position | Head |
Organism | Vavraia culicis (isolate floridensis) (Microsporidian parasite) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Pleistophoridae> Vavraia. |
Aromaticity | 0.15 |
Grand average of hydropathy | -0.324 |
Instability index | 45.80 |
Isoelectric point | 5.43 |
Molecular weight | 22924.84 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30403 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 137.25| 45| 65| 42| 92| 1 --------------------------------------------------------------------------- 42- 92 (65.17/49.82) ETVLTYF..ALSPFYDRSSLNEILKMQTqFTNFLDFSKKLTelngvKYLVDQR 108- 154 (72.08/40.68) EDLLDFYyvLFGTIYKGATTNGIFRTRV.FNLLFFINESLP.....KYLKRRR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AEHVIRDI 2) MQSLFYDTIPII | 184 1 | 191 12 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab