<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30400
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MEEESLCFYDQNFLTQNQLTPENIIQYFSFSPFYDKGCLNEILKMQSQFANIDISHKLTTLPGIYYILEHHNTDLFIIAKKKNTDQKTATLKVYYCMYGYIYCAPTARAVSNSKAIDCLSYLNEALNKYEEIKSFDWLRGFQLRADEGNSESQADDVKFVFETLHDFEAKNK |
| Length | 172 |
| Position | Head |
| Organism | Vittaforma corneae (strain ATCC 50505) (Microsporidian parasite) (Nosema corneum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Nosematidae>
Vittaforma.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.441 |
| Instability index | 51.98 |
| Isoelectric point | 5.08 |
| Molecular weight | 20105.46 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30400
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.60| 17| 27| 8| 24| 1
---------------------------------------------------------------------------
8- 24 (32.13/18.17) FYDQNFLT.....QNQLTPENI
33- 54 (26.46/14.02) FYDKGCLNeilkmQSQFANIDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.92| 12| 27| 56| 68| 2
---------------------------------------------------------------------------
56- 68 (17.90/18.33) HKLTTLPgIYYIL
86- 97 (23.02/16.80) QKTATLK.VYYCM
---------------------------------------------------------------------------
|