Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MEEESLCFYDQNFLTQNQLTPENIIQYFSFSPFYDKGCLNEILKMQSQFANIDISHKLTTLPGIYYILEHHNTDLFIIAKKKNTDQKTATLKVYYCMYGYIYCAPTARAVSNSKAIDCLSYLNEALNKYEEIKSFDWLRGFQLRADEGNSESQADDVKFVFETLHDFEAKNK |
Length | 172 |
Position | Head |
Organism | Vittaforma corneae (strain ATCC 50505) (Microsporidian parasite) (Nosema corneum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Nosematidae> Vittaforma. |
Aromaticity | 0.15 |
Grand average of hydropathy | -0.441 |
Instability index | 51.98 |
Isoelectric point | 5.08 |
Molecular weight | 20105.46 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30400 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.60| 17| 27| 8| 24| 1 --------------------------------------------------------------------------- 8- 24 (32.13/18.17) FYDQNFLT.....QNQLTPENI 33- 54 (26.46/14.02) FYDKGCLNeilkmQSQFANIDI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.92| 12| 27| 56| 68| 2 --------------------------------------------------------------------------- 56- 68 (17.90/18.33) HKLTTLPgIYYIL 86- 97 (23.02/16.80) QKTATLK.VYYCM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GYIYCAPT 2) LRADE 3) SQADDVKFVFETLHDFEAKNK 4) TATLKVYY | 99 143 152 88 | 106 147 172 95 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab