Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MASGSSMPFSSLQPTPTGGRKPKNLAEFIARVQSERGFRNVTEESLKQEIEDRKNGVADVKEEEDTAMADSNEDEEEPADANAARNEVLRNIDAANNSALMALDFISLLLSKESPAQAGTTLSAQLRDWVGIGSLGIAKREDNDEQKQRDAEKAKDNRDVSLGWALIDINTTKESADKAASHLSKEVEREEKYWGEILAVRQAGWSMCRLPAEKQTLGVRFGFSEASPEFRNSSLAPLRRGDDGSAMLQHGRIGAGCQRLGVTIGRSGKTTGRLAFGTSVPDTALLQDRVLEARNTIFAQELWHELHREAHSLASYGVRASHSAITFNPASGPSLTLELENLEDIANKAEDHPDNTLAEATHLSLHIFLSHAHRLNELQRLRPTPPHQRRNQTQNQYHLLRPIVAKILHDRAIEQVTRFSGDLTTVFRQAGVSAANFILNTPPYPTADLRNSSGGSSVRPSASQALANQITTAPADFQLELILNATCRLQIRGRTFLTPLTTTQFQVQLLPNAAEPPDPEPAPNTLQGSYPPSRDPYPSFSALKDYLTDAATHALTDWSMSLIPPPQAPSPSEPARPEWTKSIRGTAIRDIDTENREVRFDILDDADERPILNVGAAWRTADQKSKIQRWKWSPYGPAEPAQIPHIVNAVVQSSDLATSAA |
Length | 661 |
Position | Head |
Organism | Colletotrichum fructicola (strain Nara gc5) (Anthracnose fungus) (Colletotrichum gloeosporioides (strain Nara gc5)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum gloeosporioides species complex. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.565 |
Instability index | 49.49 |
Isoelectric point | 5.63 |
Molecular weight | 72621.06 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30396 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 121.27| 38| 57| 511| 550| 1 --------------------------------------------------------------------------- 511- 550 (66.63/38.97) PNAAEPPDPEPA.P...NTLQGSypPSRDPYPSFSALK.DYLTDA 564- 606 (54.64/25.77) PPPQAPSPSEPArPewtKSIRGT..AIRDIDTENREVRfDILDDA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 92.00| 28| 58| 195| 224| 2 --------------------------------------------------------------------------- 195- 224 (46.60/36.25) GEILA.VRQAGWSMCRlpAEKQTLGVRFGFS 251- 279 (45.40/28.36) GRIGAgCQRLGVTIGR..SGKTTGRLAFGTS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 128.08| 39| 57| 383| 423| 3 --------------------------------------------------------------------------- 383- 423 (63.38/40.60) PTPPHQRRNQTQNQYhlLRPIVAKILHDRAIEQVTRFSGDL 443- 481 (64.70/35.71) PYPTADLRNSSGGSS..VRPSASQALANQITTAPADFQLEL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 231.35| 79| 98| 6| 90| 4 --------------------------------------------------------------------------- 6- 90 (110.49/89.58) SMPFSSLQPTPTGGRKPKNLAEFIArVQSeRGF..RNVTEESLKQEIEDRKNGvADVKeeEDTAMADSNeDEEEPADANAAR..NEVLR 107- 189 (120.86/74.70) SLLLSKESPAQAGTTLSAQLRDWVG.IGS.LGIakREDNDEQKQRDAEKAKDN.RDVS..LGWALIDIN.TTKESADKAASHlsKEVER --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GRKPKNLAEFIARVQ 2) KIQRWKWSPYG | 19 626 | 33 636 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab