<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30388
Description |
Cell cycle control protein |
Sequence | MDTSRDSSNLLDTHNRLIADVLSRFRMLTMLATIQAEGERKNAEPQTVAVTGMSMQMEFEGLHTSVKDLLALSRRLKELWLFGKLGAGESDARIQADKLQADVVRCAEMLNAIQETRYSGLATAAGGKWAPIGRQDAAAAAPPPTAAPDGGAAAPTQPGGAGAS |
Length | 164 |
Position | Head |
Organism | Colletotrichum fructicola (strain Nara gc5) (Anthracnose fungus) (Colletotrichum gloeosporioides (strain Nara gc5)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum gloeosporioides species complex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.235 |
Instability index | 31.23 |
Isoelectric point | 5.69 |
Molecular weight | 17262.39 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30388
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.82| 17| 21| 123| 141| 1
---------------------------------------------------------------------------
123- 141 (27.98/16.74) TAA..GGKWAPigRQDAAAAA
145- 163 (27.84/11.38) TAApdGGAAAP..TQPGGAGA
---------------------------------------------------------------------------
|