<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30387
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MATAPQQTPSQPPAPPADNEPVYGGHTRFEIELEFVQSLANPYYLNHLATQKLLTRPEFVAYLAYLQYWTRPPYLKYIMYPGPTLKHLELLQQEQFRQDIISPDLVSRLIEDGMKAPVEWHRSEA |
Length | 125 |
Position | Middle |
Organism | Colletotrichum fructicola (strain Nara gc5) (Anthracnose fungus) (Colletotrichum gloeosporioides (strain Nara gc5)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum gloeosporioides species complex.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.500 |
Instability index | 72.96 |
Isoelectric point | 5.48 |
Molecular weight | 14512.36 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi
meiotic gene conversion GO:0006311 IEA:EnsemblFungi
meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP30387
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.14| 16| 19| 58| 76| 1
---------------------------------------------------------------------------
34- 52 (23.45/12.24) EFVQSLAnpyYLNHLATQ...K
58- 76 (26.69/24.16) EFVAYLA...YLQYWTRPpylK
---------------------------------------------------------------------------
|