<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30377
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MQDQSLETELSSTFPLPPQHYKLFTDHNLLAFKENQYDAIRDVDHSDMPDTVNTSGPILARFFTPPKVPTEGFYQCFHERWKIPDELPSLTEFGIQQLFDAKNGPLCAQERIAELKKMLKSLLLNFLELLGIMGIAPEQFVEKVEHIRILLLNMHHLINEYRPHQARHTLCCLVEKQVQEEKEKLLAYQNVCDDVKLLTK |
| Length | 200 |
| Position | Middle |
| Organism | Pneumocystis jirovecii (strain SE8) (Human pneumocystis pneumonia agent) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Pneumocystidomycetes> Pneumocystidaceae> Pneumocystis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.356 |
| Instability index | 44.37 |
| Isoelectric point | 5.58 |
| Molecular weight | 23271.59 |
| Publications | PubMed=23269827
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.25| 23| 26| 108| 130| 1
---------------------------------------------------------------------------
108- 130 (35.64/24.91) AQERIAELKKMLKSLLLNFLELL
136- 158 (39.61/28.41) APEQFVEKVEHIRILLLNMHHLI
---------------------------------------------------------------------------
|