Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSTQVSQQPTMSATNQFPTPASSFSGNLANPTSEDVDQGRISFSMRIQDSAENSGARPSRQPTQHRPSSHDRQPLQTDSTTDFATGQGQHSTDPDAMEVDTEPTRRADTTLSLDLDSLQKELTSAFHLCKSSPIVTGPDPSLDLVSLYGLGSIAHSVARTDPVTGEKINRLRKSYEGKLKGLGLAGRNKPLKQEIGAPGSLRYMTLWPDEEWQNQKVHGKTIKVSDMDSALQSLQSRAMQMEPGLIPNNDFWEDILGHEKQAKNPAAGETGKKIAPAPTAGRPSTQFYAASPRPQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKDHVAKVSTPMSERGASYGVGMFGIGAR |
Length | 372 |
Position | Head |
Organism | Penicillium digitatum (strain PHI26 / CECT 20796) (Green mold) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.899 |
Instability index | 43.34 |
Isoelectric point | 6.77 |
Molecular weight | 40489.28 |
Publications | PubMed=23171342 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30360 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.75| 23| 27| 25| 50| 1 --------------------------------------------------------------------------- 25- 50 (33.18/23.49) SGnlANPTSEDVdQGRISFSMR..IQ.DS 54- 79 (35.57/15.96) SG..ARPSRQPT.QHRPSSHDRqpLQtDS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 83.53| 25| 27| 112| 137| 2 --------------------------------------------------------------------------- 112- 137 (40.00/33.98) SLDLDSLQKELTSAFHLCKSSPiVTG 141- 165 (43.53/31.76) SLDLVSLYGLGSIAHSVARTDP.VTG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 36.70| 12| 232| 83| 95| 4 --------------------------------------------------------------------------- 83- 95 (19.23/11.63) FAtGQGQ....HSTDPD 315- 330 (17.47/ 6.24) FA.GYGEgfvdDDDDPG --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) MSTQVSQQPTMSATNQFPTPASSFSGNLANPTSEDVDQGRISFSMRIQDSAENSGARPSRQPTQHRPSSHDRQPLQTDSTTDFATGQGQHSTDPDAMEVDTEPTRRADTTLSLD 2) QKVHGKTIKVSDMDSALQSLQSRAMQMEPGLIPNNDFWEDILGHEKQAKNPAAGETGKKIAPAPTAGRPSTQFYAASPRPQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKDHVAKVSTPMSERGASYGVGM | 1 215 | 114 366 |
MoRF Sequence | Start | Stop |
1) GEGFV 2) KKRKKDHVAKVS | 319 341 | 323 352 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab