<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30360
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSTQVSQQPTMSATNQFPTPASSFSGNLANPTSEDVDQGRISFSMRIQDSAENSGARPSRQPTQHRPSSHDRQPLQTDSTTDFATGQGQHSTDPDAMEVDTEPTRRADTTLSLDLDSLQKELTSAFHLCKSSPIVTGPDPSLDLVSLYGLGSIAHSVARTDPVTGEKINRLRKSYEGKLKGLGLAGRNKPLKQEIGAPGSLRYMTLWPDEEWQNQKVHGKTIKVSDMDSALQSLQSRAMQMEPGLIPNNDFWEDILGHEKQAKNPAAGETGKKIAPAPTAGRPSTQFYAASPRPQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKDHVAKVSTPMSERGASYGVGMFGIGAR |
| Length | 372 |
| Position | Head |
| Organism | Penicillium digitatum (strain PHI26 / CECT 20796) (Green mold) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.899 |
| Instability index | 43.34 |
| Isoelectric point | 6.77 |
| Molecular weight | 40489.28 |
| Publications | PubMed=23171342
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30360
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.75| 23| 27| 25| 50| 1
---------------------------------------------------------------------------
25- 50 (33.18/23.49) SGnlANPTSEDVdQGRISFSMR..IQ.DS
54- 79 (35.57/15.96) SG..ARPSRQPT.QHRPSSHDRqpLQtDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.53| 25| 27| 112| 137| 2
---------------------------------------------------------------------------
112- 137 (40.00/33.98) SLDLDSLQKELTSAFHLCKSSPiVTG
141- 165 (43.53/31.76) SLDLVSLYGLGSIAHSVARTDP.VTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.70| 12| 232| 83| 95| 4
---------------------------------------------------------------------------
83- 95 (19.23/11.63) FAtGQGQ....HSTDPD
315- 330 (17.47/ 6.24) FA.GYGEgfvdDDDDPG
---------------------------------------------------------------------------
|