<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30346
| Description |
Uncharacterized protein |
| Sequence | MAATTTKARKRSRSKSTEPPPPLPPKSDENDVNNAKALLKLRQTAGKIQTAIDFCHHRILKSHIEFPNKDTGVNVETLLEYARRVAYTTSAPLNYQPGVSQLCGQLPPAPQEEHFLVSQMKKRHEEKLVHEQALQRKRQREEETTKRQKEIEEMAKLPKEELIRRLVQWKPGAAWPAGVPKPPVGWKPGDPLAFLTAKAAPNAPGEASPSKRAAAEKQPDKQEEKQQQLSLDFEEDEGEDDFDDDDAFDFDVVSASDGGDDDSD |
| Length | 264 |
| Position | Middle |
| Organism | Bathycoccus prasinos |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> Mamiellophyceae> Mamiellales>
Bathycoccaceae> Bathycoccus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.014 |
| Instability index | 73.24 |
| Isoelectric point | 5.55 |
| Molecular weight | 29563.66 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30346
No repeats found
|