<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30338
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MDIITQLQDQLDEMAVLAVNTFGTLQRDAPPDRLSSSYPDPLNPNPKPEDDSKPQVQAQPGAPPPPPAQAQAQAQPPAPDLTEQPKAMSRALVLAAKKFDALVAAVPLSSEEDQVKRIQELQAENEVVGLELQKQLEAAERELKQVEVLFNEATDNCINFKKLD |
| Length | 164 |
| Position | Middle |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.584 |
| Instability index | 54.14 |
| Isoelectric point | 4.40 |
| Molecular weight | 17941.99 |
| Publications | PubMed=19965430
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30338
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.53| 28| 30| 26| 55| 1
---------------------------------------------------------------------------
26- 55 (44.92/22.23) QRDAPPDRLSSSYPDPlNPnPKPEDDSKPQ
59- 86 (53.61/20.45) QPGAPPPPPAQAQAQA.QP.PAPDLTEQPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.02| 17| 25| 108| 124| 2
---------------------------------------------------------------------------
108- 124 (26.19/13.54) LSSEEDQVKRIQELQAE
136- 152 (25.83/13.28) LEAAERELKQVEVLFNE
---------------------------------------------------------------------------
|