<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30335
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MQFDALVAAVPLSSEEDQVKRIQELQVDIRQSD |
| Length | 33 |
| Position | Middle |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.352 |
| Instability index | 76.84 |
| Isoelectric point | 4.26 |
| Molecular weight | 3759.16 |
| Publications | PubMed=19965430
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30335
No repeats found
No repeats found
|