<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30315

Description Uncharacterized protein
SequenceMELLKPLHPHHAPILRIPFHAVPSSSSSQSQSQVPLPMISKVHVAVGKSLDKVVPLLRWTLNHFRNAEIVIVHAYQPSLTIPTLLGKLPASQASPAVVSAFRKVEREQIMKLLDKYLSICRAARVKAAIIVTEADQVQKGIVDLVIKHNIEKLVIGAVPENCMKVKRNSSKANYTAKNAPPFCEVWFIYKGKHIWTREASETPCSSSSCTQPEIATTESLRCRSFQYGKNELFDSEYLWPNSARTTAVSGIRSWVQGEIIETEATFSSKASSCCSHCSPQNSSRAYFDTYLEVMEERINKQLIETKREAEAVTDEAFTELLKCEKLEVEAMEAIRKVNLFESAHVREVKLRKEADDALRDTVQEQQKLLNESEEIAGELQMTMRNIALLDSRAQEANRRRDEAADELSLIQESISTLWQERQQIRRQKTEALRWLERWRSRGQVGAAHCNGVIGFAEELPELAEFSLSDLQNATCNFSNSFKIEQGGYSCIYKGEMLGRTVAIKKFHQHNMQGPLEFRQEVQVLGSLQHPHLITLLGVCPEAWSIVYEYLPNGTLQDYLFRKSNNSPLTWNTRARMIAEIASALCFLHSFKPETIIHGDLKPETVLLDSSLGCKMCGFGLCRLVSEESLLRPSFRLSTEPKGAFTYTDPEFQRTGILTTKSDIYSFGLIILQLLTGRTPVGLAVLVRNAVSCGKLSSILDSSAGEWPSAVAMQLVELGLQCCQQYHRDRPELTPTLVRELEQLHASEERPVPSFFSCPILQEIMHDPQVAADGFTYEGDAIREWLENGHDTSPMTNLKLSHLFLTPNYALRLAIQDWLCKS
Length821
PositionTail
OrganismGlycine max (Soybean) (Glycine hispida)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.07
Grand average of hydropathy-0.259
Instability index51.50
Isoelectric point6.40
Molecular weight92521.90
Publications
PubMed=20075913

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30315
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     130.54|      26|      26|     378|     403|       1
---------------------------------------------------------------------------
  294-  316 (20.64/12.69)	...MEERiNKQLIETK.REAEAVTDEA
  329-  354 (33.78/26.42)	EAMEAIR.KVNLFESAHVREVKLRKEA
  378-  403 (41.03/33.99)	ELQMTMR.NIALLDSRAQEANRRRDEA
  406-  431 (35.10/27.80)	ELSLIQE.SISTLWQERQQIRRQKTEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.14|      30|      42|     189|     218|       2
---------------------------------------------------------------------------
  189-  218 (56.00/38.83)	YKGKHIWTREASETPCSS.SSCTQPEIATTE
  233-  263 (50.13/33.93)	FDSEYLWPNSARTTAVSGiRSWVQGEIIETE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.81|      23|     450|      64|      89|       4
---------------------------------------------------------------------------
   64-   89 (32.93/31.27)	FRNaEIVIVHAYQ.PSLTipTLLGKLP
  517-  540 (38.88/24.10)	FRQ.EVQVLGSLQhPHLI..TLLGVCP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.86|      19|      25|     665|     683|       8
---------------------------------------------------------------------------
  665-  683 (32.21/17.95)	SFGLI..ILQLLTGRTPVGLA
  691-  711 (29.65/16.02)	SCGKLssILDSSAGEWPSAVA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30315 with Med32 domain of Kingdom Viridiplantae
Unable to open file!