<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30280
| Description |
Uncharacterized protein |
| Sequence | MDPDSKKFGGGPRELTDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYRIQPLDLNILKEAFQLKETVPIDLPAAEKGILTVAGKSKGESKDEEKKHKKHKDRDKDKDKEHKKHKHRQKDRSKDKEKEKKKDKNRHRDSSADPSKKHNEKKRKHDGDDDLNVVHKHKKSKVLISVNCIMELETHKRQ |
| Length | 192 |
| Position | Head |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.510 |
| Instability index | 40.76 |
| Isoelectric point | 9.46 |
| Molecular weight | 22196.84 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30280
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.71| 15| 15| 106| 120| 1
---------------------------------------------------------------------------
106- 120 (27.82/10.25) KDRDKDKDKEHKKHK
124- 138 (23.89/ 7.84) KDRSKDKEKEKKKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.83| 15| 15| 142| 156| 2
---------------------------------------------------------------------------
142- 156 (25.72/13.08) RDSSADPSKKHNEKK
159- 173 (27.10/14.16) HDGDDDLNVVHKHKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.91| 13| 15| 21| 33| 4
---------------------------------------------------------------------------
21- 33 (21.37/14.27) LYNVVGDIEIRKG
38- 50 (20.54/13.49) LDQLIQDTSLSSG
---------------------------------------------------------------------------
|