<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30277
| Description |
Uncharacterized protein |
| Sequence | MDPDSKKFGGDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYRIQPLDLNILKEAFQLKETVPIDLPAAEKGILTVAGKSKGESKDEEKKHKKHKDRDKDKDKEHKKHKHRQKDRSKDKEKEKKKDKNRHRDSSADPSKKHNEKKRKHDGDDDLNVVHKHKKSKHKSSKIDELGAIKVAS |
| Length | 185 |
| Position | Head |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.565 |
| Instability index | 38.68 |
| Isoelectric point | 9.54 |
| Molecular weight | 21212.64 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30277
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.84| 16| 16| 90| 105| 1
---------------------------------------------------------------------------
87- 102 (28.60/11.09) GES..KDE...EKKHKKHKDR
135- 152 (21.20/ 6.15) HRDssADP...SKKHNEKKRK
153- 171 (22.04/ 6.72) HDG..DDDlnvVHKHKKSKHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.49| 13| 16| 104| 116| 2
---------------------------------------------------------------------------
104- 116 (25.86/ 9.77) KDKDKEHKKHKHR
122- 134 (23.63/ 8.36) KDKEKEKKKDKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.96| 14| 16| 6| 21| 3
---------------------------------------------------------------------------
6- 21 (20.74/18.30) KKfgGDAHYLYNVVGD
25- 38 (25.22/14.40) RK..GDGMQLDQLIQD
---------------------------------------------------------------------------
|