<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30260
| Description |
Uncharacterized protein |
| Sequence | MNNMNMPMQQGGPMMNQMVQGNPVQMANAQHAMHPNQTPIQQAQPMEKQDNISKVKSLIGPLRDSLSVALKTAAHTLHQNSLVDTSKGIDPPDHRFNKNMEEFYSICDQIELHLRTSIECLSQNSSSVRYMPVSVMPIRPDNLSSQEALNYSQYLMTVRTQVQYIRDVYETLNHAARAISATD |
| Length | 183 |
| Position | Tail |
| Organism | Nasonia vitripennis (Parasitic wasp) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.562 |
| Instability index | 49.03 |
| Isoelectric point | 6.36 |
| Molecular weight | 20657.26 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30260
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.49| 17| 30| 1| 17| 1
---------------------------------------------------------------------------
1- 17 (35.76/18.04) MNNMNMPMQQGGPMMNQ
33- 49 (33.73/16.66) MHPNQTPIQQAQPMEKQ
---------------------------------------------------------------------------
|