<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30259
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MNRFDDPIVLRGRKPFIGMNGVPETDEQQRIRFQVELEFVQCLANPNYLNFLAQRGYFKDSTFINYLKYLLYWKEPEYAKYLKYPMCLYFLDLLQYEHFRREVVNSQCTKFIDDQQILLWQHYTRRRTRLLQTAAEQIQQHNPQQNNGIAQPKVL |
Length | 155 |
Position | Middle |
Organism | Nasonia vitripennis (Parasitic wasp) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.15 |
Grand average of hydropathy | -0.621 |
Instability index | 46.09 |
Isoelectric point | 8.96 |
Molecular weight | 18863.42 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30259
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.70| 20| 95| 28| 54| 1
---------------------------------------------------------------------------
33- 52 (35.60/27.17) FQVELEFVQCLANPNYLNFL
63- 82 (37.09/12.33) FINYLKYLLYWKEPEYAKYL
---------------------------------------------------------------------------
|