<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30254
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MPKRSTRDVLLSIVDDIEMISKELIENIIAEKHSKLSTADHTNLIELLMYKDKELKSVLVKADEQAKINQKMEALKAEVDYQDQVIQQLQRQLKETEQILATAIYQSKQKLRSIATANKRPVSSEELIKFALSTTNAMCAPLTWQQGDPRRPYPIEIEMRMGWLQQLELYNTSLTRQMFGLQSSFSSDLHMPTEPPVAQASSHFAWHPSGDLHMSVGAGQRSVPITAHKRKSEDIEMMSTDSSSTSSSDSQ |
Length | 251 |
Position | Middle |
Organism | Nasonia vitripennis (Parasitic wasp) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.533 |
Instability index | 74.13 |
Isoelectric point | 6.00 |
Molecular weight | 28405.04 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30254
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.10| 15| 22| 31| 45| 2
---------------------------------------------------------------------------
31- 45 (25.19/18.86) EKHSKLSTADHTNLI
54- 68 (22.90/16.56) ELKSVLVKADEQAKI
---------------------------------------------------------------------------
|