<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30253
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MSAPIGTAMDSLSAALKSKIIPNQEYFLQGSVLDSAVEVLLHRLRGLCDNVDTGPEQFHDHEMCFSIRRGPPPDLPLLLRVRRALDYQDMPWQLRYIGQPELGDKSQPTVVRSSLDIATSSTVVEFLNELGCRLDFEYIIRGYMFRKGRMKVTVSKIFKMNQAKIPDSMEAISQSYLVELSVLAPSGQTAIAEDIRIFAEQLKPLVQLEKINYIRQH |
Length | 217 |
Position | Head |
Organism | Nasonia vitripennis (Parasitic wasp) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.154 |
Instability index | 40.64 |
Isoelectric point | 6.43 |
Molecular weight | 24583.19 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30253
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.88| 15| 25| 61| 75| 1
---------------------------------------------------------------------------
61- 75 (30.21/17.99) HEMCFSIRRGPPPDL
88- 102 (29.67/17.57) QDMPWQLRYIGQPEL
---------------------------------------------------------------------------
|