<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30240
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGVTVLHQYPMTDNRTGSQTIDFLTKRIVALGAVQAGQFLVDCDTYMSVPQLGQQRTVHVLHNSEQPASVFAILESGNKMVPLIADGLFDLLMLKMTNIYTNKKQTKIECKGPRFELGDFCIKLGTVNMTQNFKGVLVEVEYRPCVVPGSCFELIREFVQGFLGPTVSTQVPQYLQNHMNDIYQPMDTIHQYLDHFGQYRKSTGVI |
| Length | 206 |
| Position | Head |
| Organism | Nasonia vitripennis (Parasitic wasp) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.083 |
| Instability index | 31.47 |
| Isoelectric point | 6.58 |
| Molecular weight | 23227.62 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30240
No repeats found
|