<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30238
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQREEKQLDSALEAIIMRVNDLKSAIASMIFKVEHEYETLNWPNFLDNFALISGHLTSLSKILSNEKAPNLRNLTVLPLHLSPEKDEELLRMTEGRISTFAHDLVPDYLRTKPDPLVESKMLAYEAKVANLTYDASHKQVAQYNKVINHVWDIANKAREEWESETGSRTTQTQTSSSADTHLLVYAVGNGKGLKSDAAQMVQPGVNQVGGNMMVGRPGGQPQQPGQGPMVGQMGKAPSAIKTNIKAASQIHPYGR |
| Length | 255 |
| Position | Head |
| Organism | Nasonia vitripennis (Parasitic wasp) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.485 |
| Instability index | 29.65 |
| Isoelectric point | 6.72 |
| Molecular weight | 28174.68 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30238
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.15| 15| 15| 207| 221| 1
---------------------------------------------------------------------------
207- 221 (30.97/18.33) QVGGNMMVGRPGGQP
223- 237 (31.17/18.49) QPGQGPMVGQMGKAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.97| 16| 16| 56| 71| 2
---------------------------------------------------------------------------
46- 70 (19.98/13.51) LdnfalisghLTSLSKILSNEKAPN
71- 88 (22.98/16.63) L.......rnLTVLPLHLSPEKDEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.62| 16| 16| 123| 138| 3
---------------------------------------------------------------------------
123- 138 (27.18/19.37) AYEAKVANLTYDASHK
141- 156 (29.44/21.48) AQYNKVINHVWDIANK
---------------------------------------------------------------------------
|