Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | IVDTLINRDRSAMLKNGETVENIIRLFDSKQESIKMLLKKVPEFQERENLIRTLQNHVKKRDEVIQEVENNLKACEVALTRSCFH |
Length | 85 |
Position | Middle |
Organism | Caenorhabditis japonica |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.552 |
Instability index | 52.36 |
Isoelectric point | 8.00 |
Molecular weight | 10008.46 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30231 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 36.87| 12| 25| 21| 35| 1 --------------------------------------------------------------------------- 21- 35 (15.59/17.48) ENIIRLFdskQESIK 48- 59 (21.28/13.35) ENLIRTL...QNHVK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IKMLLKKVPEFQERENLIRTLQ 2) IVDTLINRDRSAMLKNGETVENIIRLFDSK | 34 1 | 55 30 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab