<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30223
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MLPGLAAQTVSPFPNPPEYAQQYTSDRIDNVSTGSAPLPPHPHTEFCVFGEEYRLEDDVVAPLGNAGVRELYANKNHWKAEMKKLNRSAIIAFFDLVEVLIRAPDHPFREEKMNDLHTIFINMHHLINEFRPVQARDSVRILQERQIEELDNQSEHLHYMIFFSRKYLKDGREVVEDQFGNITRKLEKPPVPAELSGVALQDGLLHALIEKKVKVAEESEEGGQSESLTQKNVHIKSFISREEGPPSVTHLSIGAISEFS |
Length | 260 |
Position | Middle |
Organism | Caenorhabditis japonica |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.482 |
Instability index | 62.02 |
Isoelectric point | 5.47 |
Molecular weight | 29529.02 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30223
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.48| 20| 54| 182| 202| 1
---------------------------------------------------------------------------
182- 202 (30.45/22.47) ITRKlEKPPVPAELSGVALQD
239- 258 (35.03/21.41) ISRE.EGPPSVTHLSIGAISE
---------------------------------------------------------------------------
|