Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAVDIRDNLLGISWVDSSWIPILNNGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLHQMTGVEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDQEERDKTKPKAKKKEEPSSIFQRQRVDALLLDLRQKFPPRFVQQKPGEKPIAVDQIKKEPEPAPEAIKPEEKEAVKNAQQSTAKGPPEKRMRLQ |
Length | 245 |
Position | Head |
Organism | Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Testudines> Cryptodira> Trionychia> Trionychidae> Pelodiscus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.629 |
Instability index | 47.47 |
Isoelectric point | 8.90 |
Molecular weight | 28309.10 |
Publications | PubMed=17381049 PubMed=23624526 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl nucleoplasm GO:0005654 IEA:Ensembl |
GO - Biological Function | DNA binding GO:0003677 IEA:Ensembl transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions |
Repeats | >MDP30213 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.94| 18| 20| 186| 204| 1 --------------------------------------------------------------------------- 186- 204 (30.77/22.17) QKFP.PRFVQQKPGEKPiAV 208- 226 (28.17/15.31) KKEPePAPEAIKPEEKE.AV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IAVDQIKKEPEPAPEAIKPEEKEAVKNAQQSTAKGPPEKRMRLQ 2) RVDALLLDLRQK | 202 176 | 245 187 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab