<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30204
| Description |
Mediator complex subunit 30 |
| Sequence | MSTPPLAGTGMPPGAFSGPQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYIEEDGSKHDDRGVASQLRFASEERREIMEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 179 |
| Position | Head |
| Organism | Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Testudines> Cryptodira> Trionychia> Trionychidae>
Pelodiscus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.518 |
| Instability index | 50.17 |
| Isoelectric point | 8.46 |
| Molecular weight | 20482.36 |
| Publications | PubMed=17381049
PubMed=23624526
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP30204
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 71| 76| 96| 1
---------------------------------------------------------------------------
76- 96 (35.37/22.65) KLQEHLRQLSILFRKLR.LVYD
149- 170 (32.88/20.63) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|