| Description | Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
| Sequence | MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTM |
| Length | 49 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
| Aromaticity | 0.10 |
| Grand average of hydropathy | 0.114 |
| Instability index | 66.00 |
| Isoelectric point | 7.63 |
| Molecular weight | 5538.52 |
| Publications | PubMed=15057824 |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP30179 No repeats found No repeats found |
| Disease | papillary thyroid cancer PMID:32532820 |
| MoRF Sequence | Start | Stop |
| 1) GMMDLAYVCEWEKW 2) MCDLRRPAA | 11 1 | 24 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab