Description | Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
Sequence | MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTM |
Length | 49 |
Position | Tail |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.10 |
Grand average of hydropathy | 0.114 |
Instability index | 66.00 |
Isoelectric point | 7.63 |
Molecular weight | 5538.52 |
Publications | PubMed=15057824 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP30179 No repeats found No repeats found |
Disease | papillary thyroid cancer PMID:32532820 |
MoRF Sequence | Start | Stop |
1) GMMDLAYVCEWEKW 2) MCDLRRPAA | 11 1 | 24 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab