<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30178
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQGLLCSCGGTACSLSCRLG |
| Length | 74 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.107 |
| Instability index | 70.89 |
| Isoelectric point | 6.50 |
| Molecular weight | 8051.34 |
| Publications | PubMed=15057824
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30178
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.74| 13| 28| 30| 42| 1
---------------------------------------------------------------------------
30- 42 (29.44/12.64) CPSVPLACAWSCR
60- 72 (28.30/11.93) CSCGGTACSLSCR
---------------------------------------------------------------------------
|
Associated diseases