<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30174
Description |
Uncharacterized protein |
Sequence | PNVKQDELTAVNVKQGFSNQPAFSGDEHGSARNIVINPSKIGAYFSSILAEKLKLNTFQDTGKKKPQVNAKDNYWLVTARSQSAIHNWFSDLAGNKPLTNLAKKVSNIFHVVVLSGF |
Length | 117 |
Position | Kinase |
Organism | Ornithorhynchus anatinus (Duckbill platypus) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.368 |
Instability index | 34.16 |
Isoelectric point | 9.75 |
Molecular weight | 12857.40 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30174
No repeats found
No repeats found
|