<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30171
Description |
Uncharacterized protein |
Sequence | MSIFSPAPKTDARQDNAAGRAGSGSLTQVTDLAPSINDLDNIFDNSDDDELGVRPPLALGELASTTRA |
Length | 68 |
Position | Middle |
Organism | Ornithorhynchus anatinus (Duckbill platypus) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.416 |
Instability index | 49.14 |
Isoelectric point | 4.08 |
Molecular weight | 7058.59 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30171
No repeats found
No repeats found
|