<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30166
Description |
Uncharacterized protein |
Sequence | MSYHLPLAHHIQFIFDLMEPALNINGLIDFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHACLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFRLVQDEGFHHHQHL |
Length | 145 |
Position | Kinase |
Organism | Ornithorhynchus anatinus (Duckbill platypus) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.09 |
Grand average of hydropathy | 0.350 |
Instability index | 53.64 |
Isoelectric point | 5.86 |
Molecular weight | 16294.72 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30166
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.81| 18| 27| 43| 61| 1
---------------------------------------------------------------------------
43- 61 (26.12/22.86) AELLLKSSSLAGSYtTGLC
73- 90 (33.69/24.19) ACLILNPDQTAQVF.EGLC
---------------------------------------------------------------------------
|