<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30166
| Description |
Uncharacterized protein |
| Sequence | MSYHLPLAHHIQFIFDLMEPALNINGLIDFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHACLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFRLVQDEGFHHHQHL |
| Length | 145 |
| Position | Kinase |
| Organism | Ornithorhynchus anatinus (Duckbill platypus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.350 |
| Instability index | 53.64 |
| Isoelectric point | 5.86 |
| Molecular weight | 16294.72 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30166
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.81| 18| 27| 43| 61| 1
---------------------------------------------------------------------------
43- 61 (26.12/22.86) AELLLKSSSLAGSYtTGLC
73- 90 (33.69/24.19) ACLILNPDQTAQVF.EGLC
---------------------------------------------------------------------------
|