<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30152
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSDSGIQHQSTPTDEQKAANRARFELELEFVQSLANPFYLQSLAQQNILEQPAFINFLEYLLYWREKDYARFIHYPHALHHLELLQHARFRSEMKKDDYFRESLNQKQYDHWRTWRDPAHLTGSGRAGVDQTSSKLETNDQDATMS |
| Length | 146 |
| Position | Middle |
| Organism | Agaricus bisporus var. burnettii (strain JB137-S8 / ATCC MYA-4627 / FGSC 10392) (White button mushroom) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Agaricaceae> Agaricus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.905 |
| Instability index | 55.83 |
| Isoelectric point | 5.87 |
| Molecular weight | 17332.97 |
| Publications | PubMed=23045686
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30152
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.30| 22| 22| 38| 59| 1
---------------------------------------------------------------------------
30- 53 (29.36/17.32) FVQSLAnpFYLQSLAQQNILEQPA
54- 77 (33.94/21.01) FINFLEylLYWREKDYARFIHYPH
---------------------------------------------------------------------------
|