<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30148
| Description |
Uncharacterized protein |
| Sequence | MNISSAHADPMRIYRAKRDSAKPRVTKNYNILGFISSGTYGRVYKAQSREPDARIHAIKKFKPDKEGDVTTYTGISQSAIREIALNREISHENVVALKEVILEDKSIYMVFDYAEHDFLQLIHHHSQTLRTSISFPVLKSLTFQLLNGLLYLHSCHIIHRDLKPANILITADGVVKIGDLGLARLTYSPLQALYTGDKVVVTIWYRAPELLLGAKHYNKAIDIWAVGCVVAELASLRPIFKGEEAKLDSKKNVPFQKDQMLKIFEILGTPDERDWPGVKDMPEYPNMKRLDPYTNRLRDWCSNRMKSQLGYEFLKQTFVYDPDKRLTAHAALKHKWFQEDPIPTQNAFESLQAHQHPPPRRITYDDAPSMMPLPTQAQATQNVAQAQATQVHALSMSHSMSAKSMSGRGSAGSVGTGVGTGGAIGNGTAGGGRARKKARVG |
| Length | 441 |
| Position | Kinase |
| Organism | Phanerochaete carnosa (strain HHB-10118-sp) (White-rot fungus) (Peniophora carnosa) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Phanerochaetaceae> Phanerochaete.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.402 |
| Instability index | 37.85 |
| Isoelectric point | 9.49 |
| Molecular weight | 49260.90 |
| Publications | PubMed=22937793
|
Function
| Annotated function |
|
| GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP30148
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.54| 20| 24| 273| 293| 1
---------------------------------------------------------------------------
273- 292 (41.76/29.09) RDWPG..VKDMPEYPNMKR...LDP
298- 322 (30.78/14.65) RDWCSnrMKSQLGYEFLKQtfvYDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.83| 14| 29| 12| 25| 2
---------------------------------------------------------------------------
12- 25 (23.87/13.77) RIYRAKRDSAKPRV
42- 55 (23.96/13.85) RVYKAQSREPDARI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 98.68| 23| 23| 348| 370| 3
---------------------------------------------------------------------------
326- 345 (26.95/15.75) ....LTAHAALKHKWFQEDPIPTQ
348- 370 (42.19/28.68) FES.LQAHQHPPPRRITYDDAPSM
373- 396 (29.55/17.95) LPTqAQATQNVAQAQATQVHALSM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.55| 12| 22| 164| 175| 4
---------------------------------------------------------------------------
164- 175 (20.89/14.31) PANILITADGVV
189- 200 (21.67/15.10) PLQALYTGDKVV
---------------------------------------------------------------------------
|