<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30146
Description |
Uncharacterized protein |
Sequence | MPDEWSTNVLQHDPMRLYRQKRDTSHRSVASKYAILGFISSGTYGRVYKAQSLSDDGSIHAIKKFKPDKEGDVITYTGISQSAIREIALNREIDHENIVALREVILEDKSIYMVFEYAEHDFLQIIHHHSQTIRSAIPQVVLKSLIYQLINGLLYLHSCHILHRDLKPANILITSKGVVKIGDLGLARLCYEPLQPLFAGDKVVVTIWYRAPELLMGAKHYNKAVDSWAVGCVMAELASLRPIFKGEEAKLDSKKNVPFQRDQLLRIFEVMGTPDKKDWPGVVDMPEYHNMMKLDPYTNRLQEWCHTRIRSHQGYDLLCRLFAYDPNIRLTAKEALQHKWFHEDPKPTWNAFETVAAHQFPPHRRITQDEAPSMMPLPTQNTSHHNNGNNNNNHNNNTNNSNTNNNGGGPFGQSHSKPPSSASFASAVSGVSAGYGVQTTTTTGGSGHSRKKARLG |
Length | 456 |
Position | Kinase |
Organism | Agaricus bisporus var. burnettii (strain JB137-S8 / ATCC MYA-4627 / FGSC 10392) (White button mushroom) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Agaricaceae> Agaricus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.518 |
Instability index | 40.35 |
Isoelectric point | 8.95 |
Molecular weight | 51465.76 |
Publications | PubMed=23045686
|
Function
Annotated function |
|
GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP30146
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.22| 20| 139| 17| 53| 1
---------------------------------------------------------------------------
22- 45 (23.15/53.65) RDTSHRSVASkyAILGfISSGtYG
417- 436 (37.07/13.76) KPPSSASFAS..AVSG.VSAG.YG
---------------------------------------------------------------------------
|