<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30144

Description Uncharacterized protein (Fragment)
SequenceMAADFWLSSHHKRWIVDRATARRAREQDRQILRYLGQDVIHLDYFAIYFANVITKLGKKLGLRQRVIATATVFFRRFYLKNSYCETDPFLVIAACCYVAAKAEESPVHIKTVISEARTLFSHMYNIKHFPTDNSKLAEMEFYLVDDLECDLTVFHPYRSLLALCKKESEEPIAVNDNEPGAFNTSSIMSGNALGLGIGADDGPRYWGTGEGKLELSAGALQTAWFIVNDTYRSDICLLYPPHLIAVAAIYLTFILHTPTRSIITPLLNSPSSSQIAPVTVSSTITTTKPIRRSTRHSTSSLTSAPLPTASQQQQDPITFLSELNISLPLIATISQEIISLYTLWERYKEDAHPEA
Length355
PositionKinase
OrganismAgaricus bisporus var. burnettii (strain JB137-S8 / ATCC MYA-4627 / FGSC 10392) (White button mushroom)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Agaricaceae> Agaricus.
Aromaticity0.10
Grand average of hydropathy-0.071
Instability index54.65
Isoelectric point6.60
Molecular weight39867.10
Publications
PubMed=23045686

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30144
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.54|      17|      26|     225|     249|       1
---------------------------------------------------------------------------
  225-  241 (33.74/30.58)	FIVNDTYRSDIC.LLYPP
  253-  270 (26.81/ 8.97)	FILHTPTRSIITpLLNSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     112.58|      33|      62|      77|     109|       2
---------------------------------------------------------------------------
   77-  109 (59.39/35.01)	FYLKNSY.CETDPFLVIAACCYVAAKAEESPVHI
  141-  174 (53.19/30.74)	FYLVDDLeCDLTVFHPYRSLLALCKKESEEPIAV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.53|      20|      26|     289|     312|       3
---------------------------------------------------------------------------
  289-  312 (27.01/26.21)	PIrrsTRHSTSSLtSAPL.PTASQQ
  316-  336 (28.52/15.06)	PI...TFLSELNI.SLPLiATISQE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30144 with CycC domain of Kingdom Fungi
Unable to open file!