<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30132
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDINELHPPDDYSHRFFIWHEWIQAHGPLTTENVFDYFTTSMFYDKQSNNQVLRMQTMHTGIPIANEAEELKRFTGIEFALVHAQPPSFFIIHKRERLSPDDAKPLAAYFIVHNRIYQSPDVYSILSNRLLATVQSLQASLNILRKYRPDYTPRTGFVWPIADPNLPDDISKTRKQDSEATAPEQDSLAPDTNKNSQNAKKEQNTALLFNAMRTTAAHSRLSYSPVTAEAADTGAATATPALTQQRSSVTPAPGSQETLAKGSAATVNQIQEPPKGPPGGGKKKRKRTSLAAPPALP |
| Length | 297 |
| Position | Head |
| Organism | Agaricus bisporus var. burnettii (strain JB137-S8 / ATCC MYA-4627 / FGSC 10392) (White button mushroom) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Agaricaceae> Agaricus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.612 |
| Instability index | 52.16 |
| Isoelectric point | 8.64 |
| Molecular weight | 33006.67 |
| Publications | PubMed=23045686
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30132
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.90| 17| 17| 85| 101| 1
---------------------------------------------------------------------------
85- 101 (33.78/21.96) QP.PSFFIIHKRERLSPD
104- 121 (29.13/18.04) KPlAAYFIVHNRIYQSPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.71| 22| 24| 232| 254| 2
---------------------------------------------------------------------------
214- 232 (20.49/ 7.67) T...TAA.......HSRLSYSPVTAeaaD
233- 257 (28.33/17.34) T...GAAtATPALTQQRSSVTPAPG.sqE
258- 281 (27.90/12.81) TlakGSA.ATVNQIQEPPKGPPGGG....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.15| 11| 16| 176| 186| 3
---------------------------------------------------------------------------
176- 186 (18.30/11.00) QDSEATAPEQD
194- 204 (17.85/10.58) KNSQNAKKEQN
---------------------------------------------------------------------------
|