<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30116

Description Uncharacterized protein
SequenceMDHHHPQQYGDPYRGLVPSPQPDHHLHALQYHHQQQQPAMMSPPQAQPGLMSPPQPQQHHHASLASHFHLLHLVTRLSDAIGSGTRDQNFDALVEELTSQFARCQQLLNSISGTISSKSTTVEGQRQSLDETRQLLDQRKELITKYRSSVEDLLKGDTR
Length159
PositionMiddle
OrganismSetaria italica (Foxtail millet) (Panicum italicum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
Aromaticity0.04
Grand average of hydropathy-0.881
Instability index55.29
Isoelectric point6.51
Molecular weight18014.81
Publications
PubMed=22580951

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30116
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.45|      25|      26|       1|      26|       1
---------------------------------------------------------------------------
    1-   25 (54.48/24.57)	MDHHHPQQ....YGDP..YRGLVPSPQPDHH
   29-   59 (42.97/14.98)	LQYHHQQQqpamMSPPqaQPGLMSPPQPQQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.17|      20|      32|      64|      83|       2
---------------------------------------------------------------------------
   64-   83 (34.02/19.88)	LASHF.HLLHLVTRLSDAIGS
   97-  117 (30.15/16.96)	LTSQFaRCQQLLNSISGTISS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30116 with Med9 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MDHHHPQQYGDPYRGLVPSPQPDHHLHALQYHHQQQQPAMMSPPQAQPGLMSPPQPQQHHHASLA
1
65










Molecular Recognition Features






MoRF SequenceStartStop




NANANA