<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30115
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSYTGSAPVSDVESAPGEGEKGEKPPPRFELELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKELAHRQQYFFWKNYRNNRMKHILPRPPPEPAPAAPSQGPAVMPLPPSVPTPVAPPVPAPASSMPAVATGGASAMSPMQFVGTPGTNMPKTDMRNAMGNRKRKMG |
| Length | 209 |
| Position | Middle |
| Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.525 |
| Instability index | 61.44 |
| Isoelectric point | 9.28 |
| Molecular weight | 23474.81 |
| Publications | PubMed=22580951
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30115
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.98| 20| 22| 144| 164| 2
---------------------------------------------------------------------------
144- 164 (35.97/18.71) PAVMPLPPSVPTPVaPPVPAP
169- 188 (37.02/15.77) PAVATGGASAMSPM.QFVGTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.37| 16| 27| 33| 59| 3
---------------------------------------------------------------------------
33- 48 (30.20/37.51) LEFVQCLANPTYIHYL
63- 78 (31.17/12.78) LKYLKYWQRPEYIKYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.50| 12| 26| 85| 101| 4
---------------------------------------------------------------------------
85- 101 (18.48/22.11) FFLEllqnaNFRNA.MAH
114- 126 (23.02/13.79) FFWK.....NYRNNrMKH
---------------------------------------------------------------------------
|