<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30114
| Description |
Uncharacterized protein |
| Sequence | MSSSNQMGSDGKFGRGPRELSGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLNNVVGDTEIRKGEGMELDQLFQNSYPSEKTAYIQPFDMETLGQAFQLRETAPVDLPSAEKGTPTISGRPKIKSKDKVRKHKKHKEKDRDKEEEQKKHKHRHKDRSKDKDKDKDKDKEKKKDKSGNHESGGDHSKKHEKKRKQEVTGSSASVQNHKKTQKHKNQ |
| Length | 217 |
| Position | Head |
| Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.564 |
| Instability index | 31.29 |
| Isoelectric point | 9.72 |
| Molecular weight | 24855.61 |
| Publications | PubMed=22580951
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30114
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.91| 21| 21| 132| 152| 1
---------------------------------------------------------------------------
128- 149 (34.17/11.07) KDKvRKHK..KHKEKDRDKEEEQK
150- 173 (26.74/ 7.36) KHKhRHKDrsKDKDKDKDKDKEKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.59| 18| 21| 178| 196| 2
---------------------------------------------------------------------------
178- 196 (28.97/18.35) GNHESGGDHsKKHEKKRKQ
200- 217 (31.62/15.90) GSSASVQNH.KKTQKHKNQ
---------------------------------------------------------------------------
|