<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30111

Description Uncharacterized protein
SequenceMAPTKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEISSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDSNQLAEVEEFEDKMKELEGLCNPIIAKMYQGAGADMAGGMEDDAPAAPGGAGPKIEEVD
Length648
PositionUnknown
OrganismSetaria italica (Foxtail millet) (Panicum italicum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
Aromaticity0.06
Grand average of hydropathy-0.415
Instability index35.09
Isoelectric point5.07
Molecular weight71284.04
Publications
PubMed=22580951

Function

Annotated function
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central
GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central
GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
protein refolding	GO:0042026	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP30111
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.24|      18|      41|     338|     357|       1
---------------------------------------------------------------------------
  338-  357 (25.55/19.66)	VHDVVLVGGSTRipKVQQLL
  382-  399 (29.70/15.99)	VQAAILSGEGNE..KVQDLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     260.07|      98|     259|     140|     239|       2
---------------------------------------------------------------------------
    2-   50 (48.26/27.16)	................................................................APTKGEGPAIGIDL.GTTYSCVGVWQHDRVEIIANDQGNrttpSYVGFTD
   55-  123 (60.93/36.39)	IGDAAKNQVAMNPinTVF.DAKRLIGRrfsDASVQSDIKMwpYKVIPGPgdkPMIVVQYKGEEKQFSAEE............................................
  140-  239 (150.88/111.71)	LGLTIKNAVVTVP..AYFnDSQRQATK...DAGVIAGLNV..MRIINEP...TAAAIAYGLDKKATSVGEKNVLIFDLgGGTFDVSLLTIEEGIFEVKATAGD....THLGGED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.19|      34|      44|     428|     462|       3
---------------------------------------------------------------------------
  428-  462 (53.16/48.62)	PTKKEQVFSTYSDNQPGVLiQVYEGERTRTRDNNL
  475-  508 (57.02/46.53)	PRGVPQITVCFDIDANGIL.NVSAEDKTTGQKNKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.55|      22|     195|     315|     336|       4
---------------------------------------------------------------------------
  315-  336 (41.01/26.13)	DLFRKCMEPVEKCLRDAKMDKS
  513-  534 (37.54/23.36)	DKGRLSKEDIEKMVQDAEKYKS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP30111 with Med37 domain of Kingdom Viridiplantae

Unable to open file!