<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30103
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MIWSLAARPVLFDGTPLVVLPEPRPTPPSDPVLPLSSDYAMDNAAPNPSAAAAAAGNGVQASGTAGGERPEDASKQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVEQYREIRATSAAEAKRLAQSQSSLPNGDVKVKAEH |
| Length | 228 |
| Position | Middle |
| Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.321 |
| Instability index | 40.01 |
| Isoelectric point | 5.04 |
| Molecular weight | 24432.29 |
| Publications | PubMed=22580951
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30103
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.68| 15| 16| 89| 103| 1
---------------------------------------------------------------------------
89- 103 (25.44/18.05) LGLLHQLNLTVSSFN
108- 122 (24.25/16.90) LPLLQRLNALVAELD
---------------------------------------------------------------------------
|