<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30091
Description |
Uncharacterized protein |
Sequence | MEATVDDLSAAYDDFVAAASAVLEARAQSGGEKTAATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGSASAGSAPAPLAAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGASAPGTAGTGGAATPNAGAGPGPGGQHPEEGGQ |
Length | 158 |
Position | Tail |
Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.131 |
Instability index | 48.97 |
Isoelectric point | 4.63 |
Molecular weight | 15792.26 |
Publications | PubMed=22580951
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30091
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.19| 22| 43| 74| 95| 1
---------------------------------------------------------------------------
74- 95 (39.36/15.48) LVDE...ATGSASA.GSAPAPLAAAP
115- 140 (29.83/10.06) LVIElqhGAGGASApGTAGTGGAATP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.79| 12| 15| 17| 28| 2
---------------------------------------------------------------------------
17- 28 (19.37/11.16) AAASAVLEARAQ
35- 46 (20.42/12.12) AATDAALEAFKQ
---------------------------------------------------------------------------
|