Description | Uncharacterized protein |
Sequence | MDIITQLQEQLSEIAMLAVNTFGTLQRDAPPDRLSTSYPDPLNPNPKPEEDAKPQVQAPPGAAPAQAQPPAPPQAPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELKQVEVLFNEATDNCINLKKPE |
Length | 163 |
Position | Middle |
Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.423 |
Instability index | 57.50 |
Isoelectric point | 4.43 |
Molecular weight | 17684.87 |
Publications | PubMed=22580951 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP30080 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 90.25| 25| 26| 26| 51| 1 --------------------------------------------------------------------------- 26- 51 (43.56/21.69) QRDAPPDrLSTSYPDPLNPNPKPEED 55- 79 (46.69/19.89) QVQAPPG.AAPAQAQPPAPPQAPALD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.70| 24| 27| 107| 130| 3 --------------------------------------------------------------------------- 107- 130 (37.20/23.36) LSSEEDQLKRIQEL..QAENEVVGLE 135- 160 (32.50/19.63) LEAAELELKQVEVLfnEATDNCINLK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PQAPALDLAEQPKAMSHALVLAAKKF 2) RLSTSY | 73 33 | 98 38 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab