<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30080
| Description |
Uncharacterized protein |
| Sequence | MDIITQLQEQLSEIAMLAVNTFGTLQRDAPPDRLSTSYPDPLNPNPKPEEDAKPQVQAPPGAAPAQAQPPAPPQAPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELKQVEVLFNEATDNCINLKKPE |
| Length | 163 |
| Position | Middle |
| Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.423 |
| Instability index | 57.50 |
| Isoelectric point | 4.43 |
| Molecular weight | 17684.87 |
| Publications | PubMed=22580951
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30080
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 90.25| 25| 26| 26| 51| 1
---------------------------------------------------------------------------
26- 51 (43.56/21.69) QRDAPPDrLSTSYPDPLNPNPKPEED
55- 79 (46.69/19.89) QVQAPPG.AAPAQAQPPAPPQAPALD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.70| 24| 27| 107| 130| 3
---------------------------------------------------------------------------
107- 130 (37.20/23.36) LSSEEDQLKRIQEL..QAENEVVGLE
135- 160 (32.50/19.63) LEAAELELKQVEVLfnEATDNCINLK
---------------------------------------------------------------------------
|