<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30072

Description Uncharacterized protein
SequenceMEADERAEAARRAKEAGNDAYRKSFLETAVEHYTRGALLDPGDISFLTNRAAAYLKLCKYKECVRDCDDAAERGRELGADNRLIAKALSRKASALLELADCAGDYAPAIRALQQSLAEHYSEETLEKLNEAESVRKEVEEQERLDQEAADQHREEGNESFKQKKYHEAAMHYTRAMKMNPKDPRAFSNRAQCHIYLGDFPHGLEDAEKCVELDPTFLKGYLRKAKAQFLMESYENALATYLEGLKCDPNNLEVLDGLRRCATGIKRANGGDVELQDLKEMLGNFQSENDLHKFQKAMEQAAIFKKEASDERLMRIEAERMARTMEEYLSGLQQEMEQLKKQHGEVMEKLQKANEHLQGQLSEYRGQYERLLSEHDHLLHERDHAVREVQELRQKRGQMLSVLVTSMHCEFSSSELECATENFSSSLKIGEGGFGCVYRGILRNMTVAIKVLKHDNLQGQSQFEQEVAILSRVRHPYLVTLLGACSESSTLVYEFLPNGSLEDFLVCAEKRRTLPWQTRIRIIAEICSALTFLHKNKPHPVVHGDLKPANILLDVNLVSKLSDFGISRHLLQSSTNNTTMYRTMHPMGTLQYMDPEFFATGELTCQSDVYSFGIVVLRLLTGKPPDGIKKIVENAMLKGDLNSVVDTSAGEWPDVYAQQLAHLALSCTEPSRKCRPDLSVVVWGVVEAMRDASTIPSASSSRSVSDENGVPSYFICPIFQDVMNDPHIAADGFTYEAEAIRSWLEGHDTSPMTNMRLEHEELIPNRALRSAIQEWLQQQNMTL
Length782
PositionTail
OrganismSetaria italica (Foxtail millet) (Panicum italicum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
Aromaticity0.07
Grand average of hydropathy-0.508
Instability index42.23
Isoelectric point5.51
Molecular weight88486.21
Publications
PubMed=22580951

Function

Annotated function
GO - Cellular Component
plasma membrane	GO:0005886	IEA:UniProtKB-SubCell
plastid	GO:0009536	IEA:UniProtKB-KW
thylakoid	GO:0009579	IEA:UniProtKB-KW
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP30072
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.11|      22|      31|      66|      96|       1
---------------------------------------------------------------------------
   66-   89 (31.28/32.50)	DCddAAERGRELGADNRLIAKALS
  100-  121 (38.82/17.59)	DC..AGDYAPAIRALQQSLAEHYS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     205.08|      59|     138|       2|      60|       2
---------------------------------------------------------------------------
    2-   60 (101.00/64.59)	EADER..AEAARRAKEAGNDAYRKSFLETAVEHYTRGALLDPGDISFLTNRAAAYLKLCKY
  139-  199 (104.08/66.78)	EEQERldQEAADQHREEGNESFKQKKYHEAAMHYTRAMKMNPKDPRAFSNRAQCHIYLGDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.05|      31|      35|     293|     327|       4
---------------------------------------------------------------------------
  293-  327 (44.29/43.53)	FQKAMEQaaiFKKEASD..ERLMRIEaERMARTMEEY
  331-  363 (48.77/33.86)	LQQEMEQ...LKKQHGEvmEKLQKAN.EHLQGQLSEY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.34|      18|     185|     406|     423|       7
---------------------------------------------------------------------------
  406-  423 (34.52/21.17)	MHCE.FSSSELECATENFS
  592-  610 (29.81/17.34)	MDPEfFATGELTCQSDVYS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP30072 with Med32 domain of Kingdom Viridiplantae

Unable to open file!