<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30063
| Description |
Uncharacterized protein |
| Sequence | MLSGGYTSKKRVQERYKILGFISSGTYGRVFKAQSRTGQTGLFAIKKFKPDKEGELQYTGISQSAIREMALCTELSHPNVVHTVEIILEDKCIFIVFEYAEHDLLQIVHHHTQNPRQPIPAKTIQSILWQLLLGLQYLHQNWVMHRDLKPANIMVTGQGAVKIGDLGLARLFWKPLGSLYSGDKVVVTIWYRAPELLLGSRHYTPAIDLWAVGCIFAELLALRPIFKGEEAKLDNKKQPPFQRNQMQKIVEILGMPRAEDWPLLRAMPEYNQLPTLAAGNPRVNRPMTLRAWYDSCMRNNNYPDGPGNSPGADGFSLLQGLLEYDPQKRLTAEKALKHPYFKAGLPEGQVPSNNCFAGSSIDYPRRAVKADDNDIRTSSLPGTKRSGLPDDSLMRPSKRLKEV |
| Length | 403 |
| Position | Kinase |
| Organism | Macrophomina phaseolina (strain MS6) (Charcoal rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Macrophomina.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.387 |
| Instability index | 43.60 |
| Isoelectric point | 9.40 |
| Molecular weight | 45448.94 |
| Publications | PubMed=22992219
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30063
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.55| 17| 28| 105| 121| 2
---------------------------------------------------------------------------
105- 121 (32.60/20.02) LQIVHHHTQNPRQPIPA
135- 151 (32.95/20.31) LQYLHQNWVMHRDLKPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.52| 11| 16| 31| 42| 4
---------------------------------------------------------------------------
31- 42 (15.89/13.09) FKaQSRTGQ...TGL
48- 61 (15.63/ 7.58) FK.PDKEGElqyTGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 98.42| 24| 26| 256| 281| 5
---------------------------------------------------------------------------
258- 281 (44.57/34.86) AEDWPL.LRAMPE....YNQLPTLAAGNP
284- 310 (26.76/14.65) ..NRPMtLRAWYDscmrNNNYPDGPGNSP
312- 332 (27.08/11.43) ADGFSL.LQGLLE....YDPQKRLTA...
---------------------------------------------------------------------------
|