Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MTQIQETPLDERQWRSPLALANLQQHFGGLSSKVVHLYFMESDFFDRTANNWALFKQHGGEDWLVDRHKFEAKLREMAGLEFMVVAEPERRPDGTDTGIYIFRKQDRKKRPGQEDVITVLGTYYLIGENIYQAASLEDIIGNKILAATTSLAKFFSVASSLPIYISGRGYTYFPPSMSLKQNTASANASRRSSRAGSPTGETSSVMDMGDGPGSSQGRASDSQQPQKAKSTNAAAAATSMGALSTSFHLFKSYKDEFMDINPIIGEPGSFHFSATTRHVQQTQSKQAEAAAAAAAAKASAANADGTKTDSKPGTPALATSPDLPTAGPVLAKKPAKVKRSKSRAGTAPTSPISPTAGATPGKAL |
Length | 364 |
Position | Head |
Organism | Macrophomina phaseolina (strain MS6) (Charcoal rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae> Macrophomina. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.470 |
Instability index | 45.83 |
Isoelectric point | 9.43 |
Molecular weight | 38956.26 |
Publications | PubMed=22992219 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30058 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 128.02| 32| 56| 211| 242| 1 --------------------------------------------------------------------------- 167- 192 (34.87/12.88) .......GRGYTY..FPPS..MSLKQNTASANASRRS 211- 242 (55.70/23.93) G.PGSSQGRASDS..QQPQ..KAKSTNAAAAATSMGA 265- 301 (37.45/14.24) GePGSFHFSATTRhvQQTQskQAEAAAAAAAAKASAA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 79.65| 24| 29| 307| 332| 2 --------------------------------------------------------------------------- 307- 332 (40.69/22.55) K......TDSKPGTPalATSPDLPTAGPVLAK 333- 362 (38.96/17.18) KpakvkrSKSRAGTA..PTSPISPTAGATPGK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IYIFRK 2) PTAGPVLAKKPAKVKRSKSRAGTAPTSPI | 99 324 | 104 352 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab