<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30058
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MTQIQETPLDERQWRSPLALANLQQHFGGLSSKVVHLYFMESDFFDRTANNWALFKQHGGEDWLVDRHKFEAKLREMAGLEFMVVAEPERRPDGTDTGIYIFRKQDRKKRPGQEDVITVLGTYYLIGENIYQAASLEDIIGNKILAATTSLAKFFSVASSLPIYISGRGYTYFPPSMSLKQNTASANASRRSSRAGSPTGETSSVMDMGDGPGSSQGRASDSQQPQKAKSTNAAAAATSMGALSTSFHLFKSYKDEFMDINPIIGEPGSFHFSATTRHVQQTQSKQAEAAAAAAAAKASAANADGTKTDSKPGTPALATSPDLPTAGPVLAKKPAKVKRSKSRAGTAPTSPISPTAGATPGKAL |
| Length | 364 |
| Position | Head |
| Organism | Macrophomina phaseolina (strain MS6) (Charcoal rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Macrophomina.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.470 |
| Instability index | 45.83 |
| Isoelectric point | 9.43 |
| Molecular weight | 38956.26 |
| Publications | PubMed=22992219
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30058
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 128.02| 32| 56| 211| 242| 1
---------------------------------------------------------------------------
167- 192 (34.87/12.88) .......GRGYTY..FPPS..MSLKQNTASANASRRS
211- 242 (55.70/23.93) G.PGSSQGRASDS..QQPQ..KAKSTNAAAAATSMGA
265- 301 (37.45/14.24) GePGSFHFSATTRhvQQTQskQAEAAAAAAAAKASAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.65| 24| 29| 307| 332| 2
---------------------------------------------------------------------------
307- 332 (40.69/22.55) K......TDSKPGTPalATSPDLPTAGPVLAK
333- 362 (38.96/17.18) KpakvkrSKSRAGTA..PTSPISPTAGATPGK
---------------------------------------------------------------------------
|