<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30053
Description |
Cyclin |
Sequence | MSASYWSSTQRRFWTYSKPELAQIRRSLEDENKELVQKYPLPDRRLLHVYFCSQLNKLVRRLKLSQQAVATAQVYIRRVYTKIEIRRTNPNLVIVTALYLACKMEESPQHIRMILGEARQAWQDIILPDTSKLGECEFSLISEMNSQLIIHHPYRSLSDLQTSFKLTHEEYSQAEYVLNDHYLTDLPLLHPPHVIAIASMVIAVTLGPTQTGISMLTAANMQTAMSGLSNQQAGNAGGSPVRMQHLMNWLADSNVDIEAVADCVQEMVSLYEVWEQYNEKVCKDQINRFIRARGLEK |
Length | 297 |
Position | Kinase |
Organism | Macrophomina phaseolina (strain MS6) (Charcoal rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Macrophomina.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.286 |
Instability index | 49.57 |
Isoelectric point | 7.12 |
Molecular weight | 34143.85 |
Publications | PubMed=22992219
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30053
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.68| 17| 22| 34| 50| 1
---------------------------------------------------------------------------
34- 50 (29.94/19.58) ELVQKYPLPDRRL..LHVY
57- 75 (21.74/12.51) KLVRRLKLSQQAVatAQVY
---------------------------------------------------------------------------
|