<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30051
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPDVSTKLEPVDGQIKKVIQNLYQLVVQVHDYQGTNTEDAMKREINNLLGNLLQLSREAGHLSLQIPPEIIGYVEDGRNPDIYTRQFAELIQKNNQKLKGKSEAFAQFRDILAQKMIVAFPDMNDDVKRIVRNTGGNPETL |
| Length | 142 |
| Position | Middle |
| Organism | Macrophomina phaseolina (strain MS6) (Charcoal rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Macrophomina.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.517 |
| Instability index | 29.51 |
| Isoelectric point | 5.69 |
| Molecular weight | 16076.14 |
| Publications | PubMed=22992219
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP30051
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.38| 14| 84| 39| 52| 1
---------------------------------------------------------------------------
13- 26 (23.20/14.17) DGQIKKVIQNLYQL
39- 52 (23.18/14.15) EDAMKREINNLLGN
---------------------------------------------------------------------------
|