<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30046

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSVDPPQKRQRQTGSFSPASPPYHLAAKTAEPAKTTLHQQPDTPTSPPYMSSTAPTHSHASTASLSSASGQAVTPPSSANMSQASQQPNTNSFPTPASSAGTVSFAFKSDEADARMADDAMEGVAKSATRDVEMGNDGDHRHTGHDRTGTGSSASAVGPDSRLQSGSGPFYKLSETPYQMSRPHVSQDLVALYGLQRITQSVARFDPKTGEKINKLRKSYESHVKDFKISGGKSRPEATPGQLLNLLAFPDEEYYLQRVRGNELENAQQRILAKLNGGALKMNPGKLSKEEDGKWKTRIGTDDGLSTKRTAESSLDGAAKKLKQGGQVMQGRNSATSSPAMRPANGPKSAIRPDRAGKKRSYLDSSFKGYGEGYGDDDGIGESTGGEDNGRGAGAKKKRRKDFAAGSPLGFDERRHNVGMVGVRH
Length425
PositionHead
OrganismMacrophomina phaseolina (strain MS6) (Charcoal rot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae> Macrophomina.
Aromaticity0.05
Grand average of hydropathy-0.924
Instability index49.16
Isoelectric point9.60
Molecular weight45309.50
Publications
PubMed=22992219

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30046
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.67|      20|      25|      18|      37|       1
---------------------------------------------------------------------------
   18-   37 (37.99/20.88)	PASPPYHLA.AKTAEPAKT.TL
   44-   65 (30.68/15.53)	PTSPPYMSStAPTHSHASTaSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     150.11|      45|      45|     312|     356|       2
---------------------------------------------------------------------------
  312-  356 (76.58/35.38)	E..SSLDGAAKKLKQGGQVMQGRNSATSSPAMRPANGPKSAIRPDRA
  358-  404 (73.53/33.70)	KkrSYLDSSFKGYGEGYGDDDGIGESTGGEDNGRGAGAKKKRRKDFA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.23|      20|      25|     107|     128|       6
---------------------------------------------------------------------------
  109-  128 (31.77/18.97)	SDEADARMADDAMEGVAKSA
  135-  154 (37.45/17.37)	GNDGDHRHTGHDRTGTGSSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.37|      14|      19|      66|      79|       9
---------------------------------------------------------------------------
   66-   79 (26.24/13.12)	SSASGQ.....AVTPPSSA
   82-  100 (21.13/ 9.26)	SQASQQpntnsFPTPASSA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30046 with Med19 domain of Kingdom Fungi
Unable to open file!