<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30016
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MDVEEKPPSAFKDVSLTVDGYVLDARKLRSIEADGTLVYEEPKPPQANETETLQRIWDEVPGGFLDLTEEGLRADGDEFPEPEEEVKVEEGEKGGLMSAEDMEALRTEVCSNLNDARNELWFVFELAKTLAASSGMTSHPPPDPIPASAPQPKKKKGAAAAAAASAMASAVSTPLPSGPESELVLPAGTYSTTPGTASEPPVQLQAEKLETALRARSRALDECSNLIDAAVSELELMSNASERFASDLDQLRGKELWAIVPKPEFGRASTAPNARARDVVIPYALDEAPAALHARSLAAFDLDPSKPEMAFGARSFLRLRFLLRRGADAPTYSSAVYDASKEEGTDVCAVLRAAQAETLDEDLFHELRAEALRVDGARVEATSFTLKVGKDKLTAELYDSRSPPSTPRGELAEMLLATARLNMLHGYRRRKARIVTGTGAPHPPALVTLLSLVQFMGALDAIRPTLETIVGTLKQAGLSAHLAERHACADPTVSECLMTARAKYDVLGVVFSLDLAPGASEASRNWGGAVAAHNAAISQLGGYGPSTGGSGGRGFLSVNLTAPAAITVVVPGTSFPVKDLEALGGIVAEHAAGQIAPLLFRGIKGQPGAFYDELERCVVLGDRGPLTLEIPAPHTSLIATVDGERYDSATAGVGLEDWLKSLAGENGFRE |
| Length | 670 |
| Position | Head |
| Organism | Trichosporon asahii var. asahii (strain CBS 8904) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Trichosporonales> Trichosporonaceae> Trichosporon.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.175 |
| Instability index | 42.90 |
| Isoelectric point | 4.87 |
| Molecular weight | 71036.32 |
| Publications | PubMed=23193141
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30016
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.21| 21| 225| 274| 294| 1
---------------------------------------------------------------------------
274- 294 (37.86/22.05) ARAR.DVV.IPYALDEAPAALHA
500- 522 (27.35/13.92) ARAKyDVLgVVFSLDLAPGASEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.01| 24| 112| 97| 120| 2
---------------------------------------------------------------------------
97- 120 (42.90/31.76) MSAEDME.ALRT.....EVCSNLNDAR.NEL
204- 234 (24.18/14.46) LQAEKLEtALRArsralDECSNLIDAAvSEL
237- 256 (17.92/ 8.66) .....MS.NASE.....RFASDLDQLRgKEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 129.07| 39| 273| 322| 378| 3
---------------------------------------------------------------------------
38- 76 (69.57/33.76) VYEEPKPPQANETETLQRIWDEVPGG..FLDLTEEGLRADG
336- 376 (59.50/35.47) VYDASKEEGTDVCAVLRAAQAETLDEdlFHELRAEALRVDG
---------------------------------------------------------------------------
|