<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30016

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMDVEEKPPSAFKDVSLTVDGYVLDARKLRSIEADGTLVYEEPKPPQANETETLQRIWDEVPGGFLDLTEEGLRADGDEFPEPEEEVKVEEGEKGGLMSAEDMEALRTEVCSNLNDARNELWFVFELAKTLAASSGMTSHPPPDPIPASAPQPKKKKGAAAAAAASAMASAVSTPLPSGPESELVLPAGTYSTTPGTASEPPVQLQAEKLETALRARSRALDECSNLIDAAVSELELMSNASERFASDLDQLRGKELWAIVPKPEFGRASTAPNARARDVVIPYALDEAPAALHARSLAAFDLDPSKPEMAFGARSFLRLRFLLRRGADAPTYSSAVYDASKEEGTDVCAVLRAAQAETLDEDLFHELRAEALRVDGARVEATSFTLKVGKDKLTAELYDSRSPPSTPRGELAEMLLATARLNMLHGYRRRKARIVTGTGAPHPPALVTLLSLVQFMGALDAIRPTLETIVGTLKQAGLSAHLAERHACADPTVSECLMTARAKYDVLGVVFSLDLAPGASEASRNWGGAVAAHNAAISQLGGYGPSTGGSGGRGFLSVNLTAPAAITVVVPGTSFPVKDLEALGGIVAEHAAGQIAPLLFRGIKGQPGAFYDELERCVVLGDRGPLTLEIPAPHTSLIATVDGERYDSATAGVGLEDWLKSLAGENGFRE
Length670
PositionHead
OrganismTrichosporon asahii var. asahii (strain CBS 8904) (Yeast)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes> Trichosporonales> Trichosporonaceae> Trichosporon.
Aromaticity0.06
Grand average of hydropathy-0.175
Instability index42.90
Isoelectric point4.87
Molecular weight71036.32
Publications
PubMed=23193141

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30016
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.21|      21|     225|     274|     294|       1
---------------------------------------------------------------------------
  274-  294 (37.86/22.05)	ARAR.DVV.IPYALDEAPAALHA
  500-  522 (27.35/13.92)	ARAKyDVLgVVFSLDLAPGASEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.01|      24|     112|      97|     120|       2
---------------------------------------------------------------------------
   97-  120 (42.90/31.76)	MSAEDME.ALRT.....EVCSNLNDAR.NEL
  204-  234 (24.18/14.46)	LQAEKLEtALRArsralDECSNLIDAAvSEL
  237-  256 (17.92/ 8.66)	.....MS.NASE.....RFASDLDQLRgKEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.07|      39|     273|     322|     378|       3
---------------------------------------------------------------------------
   38-   76 (69.57/33.76)	VYEEPKPPQANETETLQRIWDEVPGG..FLDLTEEGLRADG
  336-  376 (59.50/35.47)	VYDASKEEGTDVCAVLRAAQAETLDEdlFHELRAEALRVDG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30016 with Med17 domain of Kingdom Fungi
Unable to open file!