<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30008

Description F-box-like/WD repeat-containing protein TBL1XR1
SequenceMSFTSDEVNFLVYRYLQESGFVHSAYTFGIESHISQSNINGALVPPAALLNIIMKGLQYTEAEISIGEDGAQAKNIEALTLIDAVMPDVVESKKQAAQPAPKIKTEPASTNGEEATPAEIANHTDAMEVEVGQEIPTNKATVLRGHESEVFICAWNPTNDLLASGSGDSTARIWNMNDNSCYSANQLVLRHCIQKGGTEVPSNKDVTSLDWNCEGTLLATGSYDGYARIWSTEGRLVNTLGQHKGPIFALKWNKRGNYILSAGVDKTTIIWDASSGNCTQQFAFHSAPALDVDWQSNATFASCSTDQCIHVCRLGMERPMKTFQGHTNEVNAIKWDPQGQLLASCSDDMTLKIWSMRQDPCVHDLQAHSKEIYTIKWSPTGPGTNNPNVPLILSSASFDSTVRLWEVEQGRCLHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNVQSGQLVHSYRGTGGIFEVCWNHRGDKVGASASDGSTIVLPSEGTSQPQREAQSPAHIITAPCHTQAVQCFPLKHSVH
Length526
PositionTail
OrganismCrassostrea gigas (Pacific oyster) (Crassostrea angulata)
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia> Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea.
Aromaticity0.08
Grand average of hydropathy-0.327
Instability index44.62
Isoelectric point5.58
Molecular weight57452.67
Publications
PubMed=22992520

Function

Annotated function 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU366036
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30008
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     423.35|      40|      40|     300|     339|       1
---------------------------------------------------------------------------
  133-  176 (52.14/28.41)	QEIPTNkatVLRGHESEVFICAWNPTN.........dlLA.SGSGDSTARI.WNM.
  198-  234 (39.31/19.67)	TEVP........SN.KDVTSLDWNCEG.........tlLA.TGSYDGYARIwSTEG
  235-  274 (41.77/21.34)	..RLVN...TLGQHKGPIFALKWNKRG..........nYIlSAGVDKTTII.WDAS
  275-  315 (53.79/29.54)	SGNCTQ...QFAFHSAPALDVDWQSNA..........tFA.SCSTDQCIHV.CRLG
  316-  357 (62.90/35.75)	MERPMK...TFQGHTNEVNAIKWDPQG.........qlLA.SCSDDMTLKI.WSMR
  358-  408 (56.81/31.60)	QDPCVH...DLQAHSKEIYTIKWSPTGpgtnnpnvpliLS.SASFDSTVRL.WEVE
  409-  450 (62.91/35.76)	QGRCLH...TLTKHQEPVYSVAFSPDG.........kyLA.SGSFDKCVHI.WNVQ
  451-  492 (53.72/29.49)	SGQLVH...SYRG.TGGIFEVCWNHRG........dkvGA.SASDGSTIVL.PSEG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30008 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KKQAAQPAPKIKTEPASTNGEEATPAEIANHTDAMEVEVGQEIPTNKA
93
140










Molecular Recognition Features






MoRF SequenceStartStop




NANANA