<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30003
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTSDPGPPQPYLVQPTGAPVLILPYTAPHLLPYPSHSGITGSTNLMIHYGLQNSYSKFCKKEGKEELSAFLPNLPGYIDTPGMQDNSSLRSLIENPPKTSKELVPLSGPALQGFRLHPGPLPEQYRFMSHMPRKKHKLKKKEREREKPGNMQDAQDNSPEVKTKKVKTEEKKKKKKKNKKKAKEKDDDLSHLVLTNRHSSFGCLAKSIGWLSWNTLKLTLQSSMTKLLNLTHSCWSLAALNLREHRMVW |
| Length | 249 |
| Position | Head |
| Organism | Crassostrea gigas (Pacific oyster) (Crassostrea angulata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia>
Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.804 |
| Instability index | 48.87 |
| Isoelectric point | 9.81 |
| Molecular weight | 28213.41 |
| Publications | PubMed=22992520
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30003
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 189.71| 58| 70| 24| 87| 1
---------------------------------------------------------------------------
24- 87 (93.79/60.13) PYTAPHLLPYpSHSGITGstnLMIHYG.LQNSY...SKFCKKEGKEELSAFLPNLPGyiDTPGMQDNS
97- 158 (95.92/46.65) PKTSKELVPL.SGPALQG...FRLHPGpLPEQYrfmSHMPRKKHKLKKKEREREKPG..NMQDAQDNS
---------------------------------------------------------------------------
|