<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29996
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MADQIMDWKSEQLREKVATQIENSLKWTALSSKELENSVYQRAKTREEYLELAAKSILKEKERNMTDWRAYKRN |
| Length | 74 |
| Position | Tail |
| Organism | Crassostrea gigas (Pacific oyster) (Crassostrea angulata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia>
Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -1.122 |
| Instability index | 33.58 |
| Isoelectric point | 8.96 |
| Molecular weight | 8910.01 |
| Publications | PubMed=22992520
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-KW
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29996
No repeats found
No repeats found
|