<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29996
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MADQIMDWKSEQLREKVATQIENSLKWTALSSKELENSVYQRAKTREEYLELAAKSILKEKERNMTDWRAYKRN |
Length | 74 |
Position | Tail |
Organism | Crassostrea gigas (Pacific oyster) (Crassostrea angulata) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia>
Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -1.122 |
Instability index | 33.58 |
Isoelectric point | 8.96 |
Molecular weight | 8910.01 |
Publications | PubMed=22992520
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-KW
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29996
No repeats found
No repeats found
|